Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB2M Rabbit Polyclonal Antibody (Biotin)

TFB2M Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hkp1, mtTFB2

UniProt

Q9H5Q4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFB2M

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKD

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_071761

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ASCL3 Protein Lysate
MBS137623-01 0.02 mg

Human ASCL3 Protein Lysate

Sign In for Pricing
View Details
Human ASCL3 Protein Lysate
MBS137623-02 5x 0.02 mg

Human ASCL3 Protein Lysate

Sign In for Pricing
View Details
Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)
SIPD369Ra01-01 10 µg

Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)

Sign In for Pricing
View Details
Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)
SIPD369Ra01-02 50 µg

Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)

Sign In for Pricing
View Details
Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)
SIPD369Ra01-03 200 µg

Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)

Sign In for Pricing
View Details
Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)
SIPD369Ra01-04 1 mg

Recombinant Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1)

Sign In for Pricing
View Details