Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC8 Rabbit Polyclonal Antibody (FITC)

HOXC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX3, HOX3A

UniProt

P31273

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast

Tested Applications

WB

NCBI Accession Number

NP_073149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2AIP1 (EPM2A-interacting Protein 1, Laforin-interacting Protein, EPM2AIP1, KIAA0766) (FITC) discontinued
302422-FITC 200 µL

EPM2AIP1 (EPM2A-interacting Protein 1, Laforin-interacting Protein, EPM2AIP1, KIAA0766) (FITC) discontinued

Sign In for Pricing
View Details
WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (MaxLight 550)
135388-ML550 100 µL

WISP2 (WNT1-inducible-signaling Pathway Protein 2, WISP-2, CCN Family Member 5, CCN5, Connective Tissue Growth Factor-like Protein, CTGF-L, CTGFL, Connective Tissue Growth Factor-related Protein 58, CT58, UNQ228/PRO261) (MaxLight 550)

Sign In for Pricing
View Details
HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (FITC)
247069-FITC 100 µL

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (FITC)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)
MBS7036938-01 0.02 mg

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)
MBS7036938-02 0.1 mg

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)
MBS7036938-03 5x 0.1 mg

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Uncharacterized metalloprotease BUsg_310 (BUsg_310)

Sign In for Pricing
View Details