Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC8 Rabbit Polyclonal Antibody (HRP)

HOXC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX3, HOX3A

UniProt

P31273

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast

Tested Applications

WB

NCBI Accession Number

NP_073149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syn2 sgRNA CRISPR Lentivector set (Rat)
K6826201 3x 1.0 µg

Syn2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FAM26F Protein Vector (Mouse) (pPM-C-His)
PV177809 500 ng

FAM26F Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Deoxyribonucleic acid sodium salt, Calf thymus
11010000-2 100 mg

Deoxyribonucleic acid sodium salt, Calf thymus

Sign In for Pricing
View Details
FAM185A Antibody
CSB-PA008159GA01HU 100 µL

FAM185A Antibody

Sign In for Pricing
View Details
EDD, CT (E3 Ubiquitin-protein Ligase UBR5, E3 Ubiquitin-protein Ligase, HECT Domain-containing 1, Hyperplastic Discs Protein Homolog, hHYD, Progestin-induced Protein, UBR5, EDD1, HYD, KIAA0896) (FITC) discontinued
E2202-50C-FITC 200 µL

EDD, CT (E3 Ubiquitin-protein Ligase UBR5, E3 Ubiquitin-protein Ligase, HECT Domain-containing 1, Hyperplastic Discs Protein Homolog, hHYD, Progestin-induced Protein, UBR5, EDD1, HYD, KIAA0896) (FITC) discontinued

Sign In for Pricing
View Details
Tmprss7 Rat shRNA Lentiviral Particle (Locus ID 288118)
TL704477V 500 µL Each

Tmprss7 Rat shRNA Lentiviral Particle (Locus ID 288118)

Sign In for Pricing
View Details