Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx1 Rabbit Polyclonal Antibody (Biotin)

Prrx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pmx1, Prx-1

UniProt

P63014

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Prrx1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_722543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-375-5p miRNA Inhibitor
orb1868491-01 10 nmol

Rno-miR-375-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-375-5p miRNA Inhibitor
orb1868491-02 20 nmol

Rno-miR-375-5p miRNA Inhibitor

Sign In for Pricing
View Details
OTUB1 Rabbit Polyclonal Antibody (Fluoro647)
orb3105863 100 µg

OTUB1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
CRIPT Polyclonal Antibody
orb616166-01 50 μL

CRIPT Polyclonal Antibody

Sign In for Pricing
View Details
CRIPT Polyclonal Antibody
orb616166-02 100 µL

CRIPT Polyclonal Antibody

Sign In for Pricing
View Details
STIR ELEMENT, SANDWICH STYLE DISC, Parylene C Coated NdFeB Magnet, 42MGO, PTFE Plate, 13.0mm Diameter, 13.0mm Width, 1.6mm Height, 150°C Max Operating Temp for Magnets
VP 772FN-13-13-150 10/Pack

STIR ELEMENT, SANDWICH STYLE DISC, Parylene C Coated NdFeB Magnet, 42MGO, PTFE Plate, 13.0mm Diameter, 13.0mm Width, 1.6mm Height, 150°C Max Operating Temp for Magnets

Sign In for Pricing
View Details