Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD4 Rabbit Polyclonal Antibody (FITC)

JMJD4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9H9V9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_075383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAD, Phosphorylated (S32) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)
MBS6277374-01 0.2 mL

BAD, Phosphorylated (S32) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)

Sign In for Pricing
View Details
BAD, Phosphorylated (S32) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)
MBS6277374-02 5x 0.2 mL

BAD, Phosphorylated (S32) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (Biotin)

Sign In for Pricing
View Details
NTRK1 discontinued
326365 100 µL

NTRK1 discontinued

Sign In for Pricing
View Details
TMX2 rabbit pAb
MBS8600677-01 0.1 mL

TMX2 rabbit pAb

Sign In for Pricing
View Details
TMX2 rabbit pAb
MBS8600677-02 0.1 mL (AF405L)

TMX2 rabbit pAb

Sign In for Pricing
View Details
TMX2 rabbit pAb
MBS8600677-03 0.1 mL (AF405S)

TMX2 rabbit pAb

Sign In for Pricing
View Details