Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB4 Rabbit Polyclonal Antibody (Biotin)

HOXB4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HOX2F, HOX-2.6

UniProt

P17483

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_076920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCHIP1 ORF Vector (Human) (pORF)
ORF009248 1.0 µg DNA

SCHIP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Absolute Mag™ C18 Magnetic Polystyrene Particles, 7 µm
WHM-M085 5 mL

Absolute Mag™ C18 Magnetic Polystyrene Particles, 7 µm

Sign In for Pricing
View Details
Anti-Nucleolysin TIA-1 isoform p40 TIA1 Antibody Picoband®, PE Conjugate
PA2194-PE 100 µg/Vial

Anti-Nucleolysin TIA-1 isoform p40 TIA1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
XPF (ERCC4) (NM_005236) Human Untagged Clone
SC314914 10 µg

XPF (ERCC4) (NM_005236) Human Untagged Clone

Sign In for Pricing
View Details
TRABD2B Lentiviral Activation Particles (h2)
sc-417953-LAC-2 200 µL

TRABD2B Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Adenosine Kinase Mouse Monoclonal Antibody
E38QA9325 100 µL

Adenosine Kinase Mouse Monoclonal Antibody

Sign In for Pricing
View Details