Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB4 Rabbit Polyclonal Antibody (HRP)

HOXB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2F, HOX-2.6

UniProt

P17483

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_076920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Psme1 Mouse Gene Knockout Kit (CRISPR)
KN514129 1 Kit

Psme1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1R Antibody
KC-45223-01 50 μL

C1R Antibody

Sign In for Pricing
View Details
C1R Antibody
KC-45223-02 100 µL

C1R Antibody

Sign In for Pricing
View Details