Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB4 Rabbit Polyclonal Antibody (HRP)

HOXB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2F, HOX-2.6

UniProt

P17483

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRPF4B shRNA (UAS) - Lentiviral human PRPF4B shRNA (UAS, GFP) plasmid
GTR15128542 1 Vial

Lentiviral human PRPF4B shRNA (UAS) - Lentiviral human PRPF4B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Cers1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15929126 3x 1.0µg DNA

Cers1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human Thrombopoietin, TPO ELISA KIT
E1031Hu-01 48 Well

Human Thrombopoietin, TPO ELISA KIT

Sign In for Pricing
View Details
Human Thrombopoietin, TPO ELISA KIT
E1031Hu-02 96 Well

Human Thrombopoietin, TPO ELISA KIT

Sign In for Pricing
View Details
Human Thrombopoietin, TPO ELISA KIT
E1031Hu-03 5x 96 Tests

Human Thrombopoietin, TPO ELISA KIT

Sign In for Pricing
View Details
Human Thrombopoietin, TPO ELISA KIT
E1031Hu-04 10x 96 Tests

Human Thrombopoietin, TPO ELISA KIT

Sign In for Pricing
View Details