Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB8 Rabbit Polyclonal Antibody (FITC)

HOXB8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX2, HOX2D, Hox-2.4

UniProt

P17481

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_076921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ischemia Modified Albumin (IMA) ELISA Kit
MBS2707502-01 24 Strip Well

Human Ischemia Modified Albumin (IMA) ELISA Kit

Sign In for Pricing
View Details
Human Ischemia Modified Albumin (IMA) ELISA Kit
MBS2707502-02 48 Strip Well

Human Ischemia Modified Albumin (IMA) ELISA Kit

Sign In for Pricing
View Details
Human Ischemia Modified Albumin (IMA) ELISA Kit
MBS2707502-03 96 Strip Well

Human Ischemia Modified Albumin (IMA) ELISA Kit

Sign In for Pricing
View Details
Human Ischemia Modified Albumin (IMA) ELISA Kit
MBS2707502-04 5x 96 Strip Well

Human Ischemia Modified Albumin (IMA) ELISA Kit

Sign In for Pricing
View Details
Human Ischemia Modified Albumin (IMA) ELISA Kit
MBS2707502-05 10x 96 Strip Well

Human Ischemia Modified Albumin (IMA) ELISA Kit

Sign In for Pricing
View Details
TFDP2 Over-expression Lysate Product
GWB-91B4B9 0.1 mg

TFDP2 Over-expression Lysate Product

Sign In for Pricing
View Details