Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB8 Rabbit Polyclonal Antibody (HRP)

HOXB8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2D, Hox-2.4

UniProt

P17481

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_076921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCNH8 activation kit by CRISPRa
GA115136 1 Kit

Human KCNH8 activation kit by CRISPRa

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF568 conjugate, 0.1mg/mL
BNC683647-500 1x 500 µL

Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC38A6 (NM_001172702) Human Over-expression Lysate
LY433220 100 µg

SLC38A6 (NM_001172702) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP27 (HSPB1) Rabbit Polyclonal Antibody
TA377263 100 µL

HSP27 (HSPB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS515336 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Tissue Total RNA, Smooth muscle
CR559239 5 µg

Tissue Total RNA, Smooth muscle

Sign In for Pricing
View Details