Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASS4 Rabbit Polyclonal Antibody (HRP)

LASS4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Trh1, LASS4

UniProt

Q9HA82

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LASS4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_078828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAS protein activator like-3 (RASAL3) ELISA Kit
abx541444 96 Tests

Human RAS protein activator like-3 (RASAL3) ELISA Kit

Sign In for Pricing
View Details
SLITRK1 Rabbit Polyclonal Antibody (Cy3)
orb2583725 100 µg

SLITRK1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
SUPER-X PLEX ® Human BDNF Flow Cytometry Assay - Group 4
HX88771 96 Tests

SUPER-X PLEX ® Human BDNF Flow Cytometry Assay - Group 4

Sign In for Pricing
View Details
Decamethonium bromide
M14934-01 1 g

Decamethonium bromide

Sign In for Pricing
View Details
Decamethonium bromide
M14934-02 200 mg

Decamethonium bromide

Sign In for Pricing
View Details
Decamethonium bromide
M14934-03 Inquire

Decamethonium bromide

Sign In for Pricing
View Details