Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPBAP1 Rabbit Polyclonal Antibody (HRP)

HSPBAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PASS1

UniProt

Q96EW2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HSPBAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_078886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lhx4 Rabbit Polyclonal Antibody (BF647)
orb2539975 100 µL

Lhx4 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)
MBS650359-01 0.005 mg

Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)

Sign In for Pricing
View Details
Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)
MBS650359-02 0.02 mg

Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)

Sign In for Pricing
View Details
Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)
MBS650359-03 5x 0.02 mg

Lymphotactin, Recombinant, Human (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn)

Sign In for Pricing
View Details
Hematopoietic Progenitor Cell Antigen CD34 (CD34) Antibody
abx403798-01 100 µL

Hematopoietic Progenitor Cell Antigen CD34 (CD34) Antibody

Sign In for Pricing
View Details
Hematopoietic Progenitor Cell Antigen CD34 (CD34) Antibody
abx403798-02 200 µL

Hematopoietic Progenitor Cell Antigen CD34 (CD34) Antibody

Sign In for Pricing
View Details