Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF329 Rabbit Polyclonal Antibody (Biotin)

ZNF329 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ12586

UniProt

Q86UD4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF329

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQRAHLGEQPME

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_078896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICAL1 sgRNA CRISPR Lentivector set (Human)
K1301201 3x 1.0 µg

MICAL1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GABRA2 Antibody
E91803 100 µL

GABRA2 Antibody

Sign In for Pricing
View Details
Anti-CBL Antibody Picoband® Fluoro550 Conjugated
A00152-2-Fluoro550 100 µg/Vial

Anti-CBL Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Ear10 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18854064 1.0 µg DNA

Ear10 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) (Biotin)
MBS6470669-01 0.2 mL

CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) (Biotin)

Sign In for Pricing
View Details
CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) (Biotin)
MBS6470669-02 5x 0.2 mL

CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1) (Biotin)

Sign In for Pricing
View Details