Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF668 Rabbit Polyclonal Antibody (FITC)

ZNF668 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96K58

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF668

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPMGT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

La/SSB shRNA (h) Lentiviral Particles
sc-40915-V 200 µL

La/SSB shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Anti-Lymphotactin/XCL1 Antibody Picoband® (APC Conjugate)
PB9681-APC 100 µg/Vial

Anti-Lymphotactin/XCL1 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit
MBS7202007-01 48 Well

Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit
MBS7202007-02 96 Well

Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit
MBS7202007-03 5x 96 Well

Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit
MBS7202007-04 10x 96 Well

Rabbit Bile acyl-CoA synthetase (SLC27A5) ELISA Kit

Sign In for Pricing
View Details