Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF668 Rabbit Polyclonal Antibody (HRP)

ZNF668 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96K58

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF668

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPMGT

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF125 Rabbit pAb
A15165-01 20 µL

RNF125 Rabbit pAb

Sign In for Pricing
View Details
RNF125 Rabbit pAb
A15165-02 100 μL

RNF125 Rabbit pAb

Sign In for Pricing
View Details
RNF125 Rabbit pAb
A15165-03 500 μL

RNF125 Rabbit pAb

Sign In for Pricing
View Details
RNF125 Rabbit pAb
A15165-04 1000 μL

RNF125 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Phosphoribosylformylglycinamidine cyclo-ligase (purM)
MBS1119365-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Phosphoribosylformylglycinamidine cyclo-ligase (purM)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Phosphoribosylformylglycinamidine cyclo-ligase (purM)
MBS1119365-02 0.02 mg (Yeast)

Recombinant Clostridium botulinum Phosphoribosylformylglycinamidine cyclo-ligase (purM)

Sign In for Pricing
View Details