Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF613 Rabbit Polyclonal Antibody (HRP)

ZNF613 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ13590

UniProt

Q6PF04

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF613

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DVMLENYSNLVSVGYQASKPDALFKLEQGEPWTVENEIHSQICPEIKKVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001026891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 14 3 3 eta (YWHAH) (NM_003405) AAV Particle
RC200013A1V 250 µL

Human 14 3 3 eta (YWHAH) (NM_003405) AAV Particle

Sign In for Pricing
View Details
MPPE1 ORF Vector (Human) (pORF)
30368012 1.0 µg DNA

MPPE1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
KCNJ6-IT1 Protein Vector (Human) (pPM-C-His)
PV088521 500 ng

KCNJ6-IT1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
V-Rel Reticuloendotheliosis Viral Oncogene Homolog A, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, p65 (RELA)
R1423-80 100 µg

V-Rel Reticuloendotheliosis Viral Oncogene Homolog A, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, p65 (RELA)

Sign In for Pricing
View Details
Mouse Monoclonal Adenylate Cyclase 8 Antibody (ADCY8/7573) [Janelia Fluor 585]
NBP3-24065JF585 0.1 mL

Mouse Monoclonal Adenylate Cyclase 8 Antibody (ADCY8/7573) [Janelia Fluor 585]

Sign In for Pricing
View Details
ACP4 Rabbit Polyclonal Antibody
TA339642 100 µL

ACP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details