Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grhl2 Rabbit Polyclonal Antibody (HRP)

Grhl2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1561191

UniProt

B5DEI9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Grhl2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001127999

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentacosadiynoic acid-mPEG (MW 1000)
HY-W440941 1 Each

Pentacosadiynoic acid-mPEG (MW 1000)

Sign In for Pricing
View Details
Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)
HP516107 100 µg

Anti-Human SIGLEC15/CD33L3 Antibody (A9E8)

Sign In for Pricing
View Details
PABPC3 (PABPC3, PABP3, TPABP, PABP-3, Poly (A) -Binding Protein 3, PABPL3, Poly (A) -Binding Protein-like 3, Testis PABP) discontinued
215760 50 µL

PABPC3 (PABPC3, PABP3, TPABP, PABP-3, Poly (A) -Binding Protein 3, PABPL3, Poly (A) -Binding Protein-like 3, Testis PABP) discontinued

Sign In for Pricing
View Details
Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 550)
MBS6455905-01 0.1 mL

Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 550)

Sign In for Pricing
View Details
Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 550)
MBS6455905-02 5x 0.1 mL

Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 550)

Sign In for Pricing
View Details
PLB (Phospholipase B, PL-B1, PLB1, PLB/LIP, Phospholipase B1, Membrane-associated, Phospholipase B/lipase, Lysophospholipase, Phospholipase A2)
364677 200 µL

PLB (Phospholipase B, PL-B1, PLB1, PLB/LIP, Phospholipase B1, Membrane-associated, Phospholipase B/lipase, Lysophospholipase, Phospholipase A2)

Sign In for Pricing
View Details