Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN16 Rabbit Polyclonal Antibody (FITC)

ZSCAN16 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF392, ZNF435, dJ265C24.3

UniProt

Q9H4T2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor protein p63-regulated gene 1-Like protein (TPRG1L) Rat ELISA Kit
H9541 96 Tests

Tumor protein p63-regulated gene 1-Like protein (TPRG1L) Rat ELISA Kit

Sign In for Pricing
View Details
ZIC1 Antibody, mAb, Rabbit
A03819-100 100 µL

ZIC1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
OsMKK8t Antibody
abx018506 100 µL

OsMKK8t Antibody

Sign In for Pricing
View Details
Human ADORA2B Protein, hFc Tag
orb1291058-01 10 µg

Human ADORA2B Protein, hFc Tag

Sign In for Pricing
View Details
Human ADORA2B Protein, hFc Tag
orb1291058-02 50 µg

Human ADORA2B Protein, hFc Tag

Sign In for Pricing
View Details
Human ADORA2B Protein, hFc Tag
orb1291058-03 100 µg

Human ADORA2B Protein, hFc Tag

Sign In for Pricing
View Details