Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN16 Rabbit Polyclonal Antibody (HRP)

ZSCAN16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF392, ZNF435, dJ265C24.3

UniProt

Q9H4T2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6,  40nm
GM-210-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6, 40nm

Sign In for Pricing
View Details
galectin 9 (LGALS9) (N-term) Rabbit Polyclonal Antibody
AP52470PU-N 400 µL

galectin 9 (LGALS9) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sancycline Hydrochloride
TRC-S111500-50MG 50 mg

Sancycline Hydrochloride

Sign In for Pricing
View Details
Rhein 8-Glucoside
TRC-R318520-25MG 25 mg

Rhein 8-Glucoside

Sign In for Pricing
View Details
RALGAPA1 Polyclonal Antibody
E-AB-17987-01 20 µL

RALGAPA1 Polyclonal Antibody

Sign In for Pricing
View Details
RALGAPA1 Polyclonal Antibody
E-AB-17987-02 60 µL

RALGAPA1 Polyclonal Antibody

Sign In for Pricing
View Details