Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN16 Rabbit Polyclonal Antibody (Biotin)

ZSCAN16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF392, ZNF435, dJ265C24.3

UniProt

Q9H4T2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZSCAN16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDFSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (PE)
252534-PE 100 µL

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (PE)

Sign In for Pricing
View Details
Bromfenac sodium hydrate 10mM * 1mL in DMSO
A18194-10mM-D 10 mM x 1mL in DMSO

Bromfenac sodium hydrate 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Human ST2 ELISA Kit
orb2975521 96 Tests

Human ST2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO
bs-104537P-01 20 µg

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO
bs-104537P-02 50 µg

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Sign In for Pricing
View Details
Anti-Mouse F4/80 Antigen
RM923920 0.1 mg

Anti-Mouse F4/80 Antigen

Sign In for Pricing
View Details