Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhe41 Rabbit Polyclonal Antibody (FITC)

Bhlhe41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Dec2, Bhlhb3, Sharp1, SHARP-1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001074956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-POU2F3 Antibody Picoband®
A09040-1 100 µg/Vial

Anti-POU2F3 Antibody Picoband®

Sign In for Pricing
View Details
CDK5 (Cyclin Dependent Kinase 5) BioAssayTM ELISA Kit (Rat) discontinued
382297 96 Tests

CDK5 (Cyclin Dependent Kinase 5) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
PDCD4 (H731, Programmed cell death protein 4, Neoplastic transformation Inhibitor protein, Nuclear antigen H731-like, Protein 197/15a)
330659-01 50 µL

PDCD4 (H731, Programmed cell death protein 4, Neoplastic transformation Inhibitor protein, Nuclear antigen H731-like, Protein 197/15a)

Sign In for Pricing
View Details
PDCD4 (H731, Programmed cell death protein 4, Neoplastic transformation Inhibitor protein, Nuclear antigen H731-like, Protein 197/15a)
330659-02 100 µL

PDCD4 (H731, Programmed cell death protein 4, Neoplastic transformation Inhibitor protein, Nuclear antigen H731-like, Protein 197/15a)

Sign In for Pricing
View Details
Human TMPRSS4 (Transmembrane Protease, Serine 4) ELISA Kit
MBS8802731-01 48 Well

Human TMPRSS4 (Transmembrane Protease, Serine 4) ELISA Kit

Sign In for Pricing
View Details
Human TMPRSS4 (Transmembrane Protease, Serine 4) ELISA Kit
MBS8802731-02 96 Well

Human TMPRSS4 (Transmembrane Protease, Serine 4) ELISA Kit

Sign In for Pricing
View Details