Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf25 Rabbit Polyclonal Antibody (HRP)

C1orf25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM1L, MST070, C1orf25, MSTP070, bG120K12.3

UniProt

Q7Z2T5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_112196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 Human Gene Knockout Kit (CRISPR)
KN417852 1 Kit

NRF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TYW1B activation kit by CRISPRa
GA118497 1 Kit

Human TYW1B activation kit by CRISPRa

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), Biotin conjugate, 0.1mg/mL
BNCB2540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYBPH (NM_004997) Human Recombinant Protein
TP308162 20 µg

MYBPH (NM_004997) Human Recombinant Protein

Sign In for Pricing
View Details
Di N-Oxide Abemaciclib
TRC-O121920-250MG 250 mg

Di N-Oxide Abemaciclib

Sign In for Pricing
View Details
Mouse Cd19 activation kit by CRISPRa
GA200603 1 Kit

Mouse Cd19 activation kit by CRISPRa

Sign In for Pricing
View Details