Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf25 Rabbit Polyclonal Antibody (HRP)

C1orf25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRM1L, MST070, C1orf25, MSTP070, bG120K12.3

UniProt

Q7Z2T5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_112196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC1 Antibody
8C19143-AAT 50 µg

TRAPPC1 Antibody

Sign In for Pricing
View Details
Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 30nm
CCG-1001-30 1 mL

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 30nm

Sign In for Pricing
View Details
Brms1l Mouse Gene Knockout Kit (CRISPR)
KN502272 1 Kit

Brms1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RBM28 (NM_001166135) Human Over-expression Lysate
LC431533 20 µg

RBM28 (NM_001166135) Human Over-expression Lysate

Sign In for Pricing
View Details
PNLDC1 Recombinant Rabbit monoclonal Antibody
HA723122 100 µL

PNLDC1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS701552 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details