Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM56 Rabbit Polyclonal Antibody (FITC)

TRIM56 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF109

UniProt

Q9BRZ2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM56

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_112223

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Collagen IV alpha 1 Antibody (1043) [DyLight 755]
NBP1-97716IR 0.1 mL

Mouse Monoclonal Collagen IV alpha 1 Antibody (1043) [DyLight 755]

Sign In for Pricing
View Details
Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit
E-EL-MK2246-01 24 Tests

Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit

Sign In for Pricing
View Details
Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit
E-EL-MK2246-02 48 Tests

Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit

Sign In for Pricing
View Details
Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit
E-EL-MK2246-03 96 Tests

Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit

Sign In for Pricing
View Details
Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit
E-EL-MK2246-04 5x 96 Tests

Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit

Sign In for Pricing
View Details
Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit
E-EL-MK2246-05 10x 96 Tests

Monkey CTXⅠ-Cross Linked C-telopeptide of Type Ⅰ Collagen- ELISA Kit

Sign In for Pricing
View Details