Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPGK Rabbit Polyclonal Antibody (HRP)

ADPGK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADP-GK, 2610017G09Rik

UniProt

Q9BRR6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADPGK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_112574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc5a7 Pre-designed siRNA Set A
SI113279A 1 Each

Mouse Slc5a7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FLRT1 (Leucine-rich Repeat Transmembrane Protein FLRT1, Fibronectin-like Domain-containing Leucine-rich Transmembrane Protein 1, UNQ752/PRO1483) (MaxLight 490)
MBS6200866-01 0.1 mL

FLRT1 (Leucine-rich Repeat Transmembrane Protein FLRT1, Fibronectin-like Domain-containing Leucine-rich Transmembrane Protein 1, UNQ752/PRO1483) (MaxLight 490)

Sign In for Pricing
View Details
FLRT1 (Leucine-rich Repeat Transmembrane Protein FLRT1, Fibronectin-like Domain-containing Leucine-rich Transmembrane Protein 1, UNQ752/PRO1483) (MaxLight 490)
MBS6200866-02 5x 0.1 mL

FLRT1 (Leucine-rich Repeat Transmembrane Protein FLRT1, Fibronectin-like Domain-containing Leucine-rich Transmembrane Protein 1, UNQ752/PRO1483) (MaxLight 490)

Sign In for Pricing
View Details
Anti-Human CXCL10/IP-10 Antibody (SAA0413)
FHC01910 100 μg

Anti-Human CXCL10/IP-10 Antibody (SAA0413)

Sign In for Pricing
View Details
Uroplakin-1b (UPK1B) Human ELISA Kit
I1595 96 Tests

Uroplakin-1b (UPK1B) Human ELISA Kit

Sign In for Pricing
View Details
Anti-TBX18 Antibody Picoband® Fluoro594 Conjugated
A06044-2-Fluoro594 100 µg/Vial

Anti-TBX18 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details