Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan14 Rabbit Polyclonal Antibody (FITC)

Zkscan14 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zfp9, Zfp99, Znf394, 2310046C23Rik, 2810437E14Rik

UniProt

Q9Z1D9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CGRRFSQSATLIKHQRTHTGEKPYKCFQCGERFRQSTHLVRHQRIHQNSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)
orb2987239-01 100 µL

Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)

Sign In for Pricing
View Details
Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)
orb2987239-02 500 µL

Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)

Sign In for Pricing
View Details
Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)
orb2987239-03 1 mL

Goat Anti-Quail IgY (H&L) Antibody (AcalephFluor750)

Sign In for Pricing
View Details
Ig λ light chain (ICO106) FITC
sc-59267 FITC 200 µg/mL

Ig λ light chain (ICO106) FITC

Sign In for Pricing
View Details
Magenta phosphate disodium salt monohydrate
B-490-5-25g 25 g

Magenta phosphate disodium salt monohydrate

Sign In for Pricing
View Details
Cow Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor (ADCYAP1R1) ELISA Kit
abx555763 96 Tests

Cow Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor (ADCYAP1R1) ELISA Kit

Sign In for Pricing
View Details