Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF644 Rabbit Polyclonal Antibody (Biotin)

ZNF644 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NatF, MYP21, ZEP-2, BM-005

UniProt

Q9H582

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF644

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

149kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_958357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)
MBS2102405-01 5x 96 Tests

Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)
MBS2102405-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)
MBS2102405-03 10x 96 Tests

Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)
MBS2102405-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Troponin T Type 1, Slow Skeletal (TNNT1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Recombinant Lachancea thermotolerans ATPase synthesis protein 25, mitochondrial (ATP25), partial
MBS1172160 Inquire

Recombinant Lachancea thermotolerans ATPase synthesis protein 25, mitochondrial (ATP25), partial

Sign In for Pricing
View Details
LPP (NM_001167672) Human Tagged ORF Clone
RG230130 10 µg

LPP (NM_001167672) Human Tagged ORF Clone

Sign In for Pricing
View Details