Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARFGAP2 Rabbit Polyclonal Antibody (HRP)

ARFGAP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IRZ, ZFP289, ZNF289, NBLA10535

UniProt

G5E9L0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ARFGAP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229761.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAN2B1 (Mannosidase Alpha Class 2B Member 1) ELISA Kit
EK244347 96 Well

Human MAN2B1 (Mannosidase Alpha Class 2B Member 1) ELISA Kit

Sign In for Pricing
View Details
Retinoblastoma, phosphorylated Serine (Rb) (BSA & Azide Free) (MaxLight 650) discontinued
R1660-19DX-ML650 100 µL

Retinoblastoma, phosphorylated Serine (Rb) (BSA & Azide Free) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Adra2a ORF Vector (Mouse) (pORF)
11446014 1.0 µg DNA

Adra2a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Gomisin S
MBS5760439 Inquire

Gomisin S

Sign In for Pricing
View Details
Porcine Heat Shock Protein 70,HSP-70 ELISA KIT
JOT-EK0242Po 96 wells

Porcine Heat Shock Protein 70,HSP-70 ELISA KIT

Sign In for Pricing
View Details
Mmu-miR-361-3p mimic
HY-R03092-01 5 nmol

Mmu-miR-361-3p mimic

Sign In for Pricing
View Details