Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGBD1 Rabbit Polyclonal Antibody (HRP)

PGBD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAND4, HUCEP-4, dJ874C20.4

UniProt

Q96JS3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGBD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human T cell receptor delta joining 1 (TRDJ1)
orb3004429-01 20 µg

Recombinant Human T cell receptor delta joining 1 (TRDJ1)

Sign In for Pricing
View Details
Recombinant Human T cell receptor delta joining 1 (TRDJ1)
orb3004429-02 100 µg

Recombinant Human T cell receptor delta joining 1 (TRDJ1)

Sign In for Pricing
View Details
Recombinant Human T cell receptor delta joining 1 (TRDJ1)
orb3004429-03 1 mg

Recombinant Human T cell receptor delta joining 1 (TRDJ1)

Sign In for Pricing
View Details
NEK10 Conjugated Antibody
orb1620667 100 µL

NEK10 Conjugated Antibody

Sign In for Pricing
View Details
Ulefnersen (sodium)
HY-147410A-01 1 mg

Ulefnersen (sodium)

Sign In for Pricing
View Details
Ulefnersen (sodium)
HY-147410A-02 5 mg

Ulefnersen (sodium)

Sign In for Pricing
View Details