Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Rabbit Polyclonal Antibody (HRP)

ATOH8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HATH6, bHLHa21

UniProt

Q96SQ7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ATOH8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116216

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 1 Epsilon (CSNK1E) Antibody
abx212618-01 50 µL

Casein Kinase 1 Epsilon (CSNK1E) Antibody

Sign In for Pricing
View Details
Casein Kinase 1 Epsilon (CSNK1E) Antibody
abx212618-02 100 µL

Casein Kinase 1 Epsilon (CSNK1E) Antibody

Sign In for Pricing
View Details
BSEP (Bile Salt Export Pump, ABCB11) discontinued
474342-01 100 µL

BSEP (Bile Salt Export Pump, ABCB11) discontinued

Sign In for Pricing
View Details
BSEP (Bile Salt Export Pump, ABCB11) discontinued
474342-02 1 mL

BSEP (Bile Salt Export Pump, ABCB11) discontinued

Sign In for Pricing
View Details
Npy2r (Neuropeptide Y Receptor Type 2, NPY2-R, NPY-Y2 Receptor, Y2 Receptor, Npy2r) (APC) discontinued
302609-APC 200 µL

Npy2r (Neuropeptide Y Receptor Type 2, NPY2-R, NPY-Y2 Receptor, Y2 Receptor, Npy2r) (APC) discontinued

Sign In for Pricing
View Details
Bla Recombinant Protein
OPCA02893-20UG 20 µg

Bla Recombinant Protein

Sign In for Pricing
View Details