Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNB3 Rabbit Polyclonal Antibody (FITC)

CCNB3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CYCB3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNB3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_391991

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 Rabbit mAb
orb1924078-01 50 µL

CD7 Rabbit mAb

Sign In for Pricing
View Details
CD7 Rabbit mAb
orb1924078-02 100 µL

CD7 Rabbit mAb

Sign In for Pricing
View Details
UBA6 (Ubiquitin-like modifier Activating Enzyme 6, FLJ10808, FLJ23367, MOP-4, UBE1L2) (AP)
MBS6164868-01 0.1 mL

UBA6 (Ubiquitin-like modifier Activating Enzyme 6, FLJ10808, FLJ23367, MOP-4, UBE1L2) (AP)

Sign In for Pricing
View Details
UBA6 (Ubiquitin-like modifier Activating Enzyme 6, FLJ10808, FLJ23367, MOP-4, UBE1L2) (AP)
MBS6164868-02 5x 0.1 mL

UBA6 (Ubiquitin-like modifier Activating Enzyme 6, FLJ10808, FLJ23367, MOP-4, UBE1L2) (AP)

Sign In for Pricing
View Details
BASE150X12CARD-T1-P21 Pipe Markers for Acids & Bases
N001835 5 Card (5 Marker (s) x 1 Card)

BASE150X12CARD-T1-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
PLG Antibody
orb674134-01 50 µg

PLG Antibody

Sign In for Pricing
View Details