Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF682 Rabbit Polyclonal Antibody (FITC)

ZNF682 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BC39498_3

UniProt

O95780

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF682

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENYRNLVSLGLTVSKPELISRLEQRQEPWNVKRHETIAKPPAMSSHYTED

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_149973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Apolipoprotein B100 (Apo-B100) ELISA Kit
EIA05307p 1 Kit

Porcine Apolipoprotein B100 (Apo-B100) ELISA Kit

Sign In for Pricing
View Details
FGFR2, NT (R22) (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (PE) discontinued
F4305-16G-PE 200 µL

FGFR2, NT (R22) (Fibroblast Growth Factor Receptor 2, FGFR-2, Keratinocyte Growth Factor Receptor, K-sam, CD332, BEK, KGFR, KSAM) (PE) discontinued

Sign In for Pricing
View Details
Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit
MBS2502336-01 24 Tests

Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit
MBS2502336-02 48 Tests

Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit
MBS2502336-03 96 Tests

Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit
MBS2502336-04 5x 96 Tests

Guinea pig SEMA3A (Semaphorin 3A) ELISA Kit

Sign In for Pricing
View Details