Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD6 Rabbit Polyclonal Antibody (Biotin)

BTBD6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BDPL

UniProt

Q96KE9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BTBD6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_150374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EJM2 3'UTR Luciferase Stable Cell Line
TU006806 1.0 mL

EJM2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Slc23a3 3'UTR GFP Stable Cell Line
TU168979 1.0 mL

Slc23a3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL)
406038-01 20 µg

Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL)

Sign In for Pricing
View Details
Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL)
406038-02 100 µg

Serotype M6 50S Ribosomal Protein L7/L12, Recombinant, Streptococcus pyogenes, aa1-121, His-SUMO-Tag, Myc-Tag (rplL)

Sign In for Pricing
View Details
PDYN (Proenkephalin-B, Beta-neoendorphin-dynorphin, Preprodynorphin, MGC26418) (MaxLight 490)
MBS6388993-01 0.1 mL

PDYN (Proenkephalin-B, Beta-neoendorphin-dynorphin, Preprodynorphin, MGC26418) (MaxLight 490)

Sign In for Pricing
View Details
PDYN (Proenkephalin-B, Beta-neoendorphin-dynorphin, Preprodynorphin, MGC26418) (MaxLight 490)
MBS6388993-02 5x 0.1 mL

PDYN (Proenkephalin-B, Beta-neoendorphin-dynorphin, Preprodynorphin, MGC26418) (MaxLight 490)

Sign In for Pricing
View Details