Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trerf1 Rabbit Polyclonal Antibody (HRP)

Trerf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAPA, Trep1, Trep-1, Trep132, AI429294, Trep-132, B830015H24, 9430096I18Rik

UniProt

Q8BXJ2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGDQQLYKTNHVGHGGENLFYQQPPLGVHSGLGHSYGNTISGAGMDAPQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

132kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_766210

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEACAM-16 Alexa Fluor 488 MAb (Cl 2747B)
FAB9885G-100UG 100 µg

Human CEACAM-16 Alexa Fluor 488 MAb (Cl 2747B)

Sign In for Pricing
View Details
TRNAI2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2492707 1.0 µg DNA

TRNAI2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human ZBED4 Recombinant Protein (N-His)
HC953012-01 50 µg

Human ZBED4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZBED4 Recombinant Protein (N-His)
HC953012-02 100 µg

Human ZBED4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZBED4 Recombinant Protein (N-His)
HC953012-03 1 mg

Human ZBED4 Recombinant Protein (N-His)

Sign In for Pricing
View Details
E2F8 siRNA (Mouse)
CRN0982-01 15 nmol

E2F8 siRNA (Mouse)

Sign In for Pricing
View Details