Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM41 Rabbit Polyclonal Antibody (Biotin)

TRIM41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RINCK

UniProt

Q8WV44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM41

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_963921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWC3 Antibody
CSB-PA890929NA01HU-01 50 μL

WWC3 Antibody

Sign In for Pricing
View Details
WWC3 Antibody
CSB-PA890929NA01HU-02 100 µL

WWC3 Antibody

Sign In for Pricing
View Details
MUC5AC (Mucin 5 Subtype AC, TBM, MUC5, LeB, Oligomeric Mucus/Gel-Forming, Mucin 5, Subtypes A And C, Tracheobronchial/Gastric, Gastric mucin, Lewis B blood group antigen, Major airway glycoprotein)
364248 200 µL

MUC5AC (Mucin 5 Subtype AC, TBM, MUC5, LeB, Oligomeric Mucus/Gel-Forming, Mucin 5, Subtypes A And C, Tracheobronchial/Gastric, Gastric mucin, Lewis B blood group antigen, Major airway glycoprotein)

Sign In for Pricing
View Details
Astell Autofill 63L Autoclave Front Loading
AUT4304 1 Each

Astell Autofill 63L Autoclave Front Loading

Sign In for Pricing
View Details
Kdm4d 3'UTR Luciferase Stable Cell Line
TU206660 1.0 mL

Kdm4d 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLD3 Antibody / 5'-3' exonuclease PLD3
RQ6670 100 µg

PLD3 Antibody / 5'-3' exonuclease PLD3

Sign In for Pricing
View Details