Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Egln2 Rabbit Polyclonal Antibody (FITC)

Egln2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PHD1, HPH-1, HPH-3, PHD-1, HIF-PH1

UniProt

Q6AYU4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mEPOA Protein
orb752934-01 2 µg

Mouse mEPOA Protein

Sign In for Pricing
View Details
Mouse mEPOA Protein
orb752934-02 10 µg

Mouse mEPOA Protein

Sign In for Pricing
View Details
Mouse mEPOA Protein
orb752934-03 100 µg

Mouse mEPOA Protein

Sign In for Pricing
View Details
Advanced stage multiple esophagus cancer and normal tissue array, including pathology grade, TNM and clinical stage (AJCC 8.0), 93 cases/93 cores
ES931 1 Each

Advanced stage multiple esophagus cancer and normal tissue array, including pathology grade, TNM and clinical stage (AJCC 8.0), 93 cases/93 cores

Sign In for Pricing
View Details
PLV3-U6-Tgm2-shRNA1-CopGFP-Puro Plasmid
PVT72835 2 µg

PLV3-U6-Tgm2-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
MAGED2 (Melanoma Antigen Family D, 2, 11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386)
248405 50 µL

MAGED2 (Melanoma Antigen Family D, 2, 11B6, BCG1, HCA10, JCL-1, MAGE-D2, MAGED, MGC8386)

Sign In for Pricing
View Details