Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF545 Rabbit Polyclonal Antibody (Biotin)

ZNF545 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF545

UniProt

Q8N141

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF545

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_597723

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Protein S100-A9 polyclonal Antibody
MBS7001469-01 0.05 mg

Rabbit anti-human Protein S100-A9 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Protein S100-A9 polyclonal Antibody
MBS7001469-02 0.1 mg

Rabbit anti-human Protein S100-A9 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Protein S100-A9 polyclonal Antibody
MBS7001469-03 5x 0.1 mg

Rabbit anti-human Protein S100-A9 polyclonal Antibody

Sign In for Pricing
View Details
Multiplex Assay Kit for Growth Differentiation Factor 9 (GDF9), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026175 96 Tests

Multiplex Assay Kit for Growth Differentiation Factor 9 (GDF9), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
USO1 (Protein USO1 Homolog, General Vesicular Transport Factor p115, Transcytosis-associated Protein, TAP, Vesicle-docking Protein, VDP)
135144 100 µg

USO1 (Protein USO1 Homolog, General Vesicular Transport Factor p115, Transcytosis-associated Protein, TAP, Vesicle-docking Protein, VDP)

Sign In for Pricing
View Details
Guinea pig a2 Microglobulin ELISA Kit
MBS732705-01 48 Well

Guinea pig a2 Microglobulin ELISA Kit

Sign In for Pricing
View Details