Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREB1 Rabbit Polyclonal Antibody (FITC)

CREB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CREB, CREB-1

UniProt

P16220

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CREB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_604391

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLL3 Antibody Blocking peptide
orb1448285 500 µg

MLL3 Antibody Blocking peptide

Sign In for Pricing
View Details
Beta 3 Adrenergic Receptor (ADRB3) Human Over-expression Lysate
orb1341557 100 µg

Beta 3 Adrenergic Receptor (ADRB3) Human Over-expression Lysate

Sign In for Pricing
View Details
Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit
MBS9927835-01 48 Well

Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit

Sign In for Pricing
View Details
Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit
MBS9927835-02 96 Well

Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit

Sign In for Pricing
View Details
Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit
MBS9927835-03 5x 96 Well

Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit

Sign In for Pricing
View Details
Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit
MBS9927835-04 10x 96 Well

Sheep U5 Small Nuclear Ribonucleoprotein 40 kDa Protein (SNRNP40) ELISA Kit

Sign In for Pricing
View Details