Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF689 Rabbit Polyclonal Antibody (FITC)

ZNF689 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIPUH1

UniProt

Q96CS4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF689

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_612456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM2P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2071608 1.0 µg DNA

RRM2P4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
APIP (1-242, His-tag) Human Protein
AR50438PU-S 100 µg

APIP (1-242, His-tag) Human Protein

Sign In for Pricing
View Details
Histidine Triad Nucleotide-binding Protein 1, Control Peptide (HINT1, Adenosine 5'-monophosphoramidase, FLJ30414, FLJ32340, HINT, PKCI1, PKCI-1, PRKCNH1, Protein kinase C inhibitor 1, Protein kinase C-interacting protein 1)
149098 50 µg

Histidine Triad Nucleotide-binding Protein 1, Control Peptide (HINT1, Adenosine 5'-monophosphoramidase, FLJ30414, FLJ32340, HINT, PKCI1, PKCI-1, PRKCNH1, Protein kinase C inhibitor 1, Protein kinase C-interacting protein 1)

Sign In for Pricing
View Details
Lentiviral human B3GNT6 shRNA (UAS) - Lentiviral human B3GNT6 shRNA (UAS) plasmid
GTR15085267 1 Vial

Lentiviral human B3GNT6 shRNA (UAS) - Lentiviral human B3GNT6 shRNA (UAS) plasmid

Sign In for Pricing
View Details
NBPF11 Rabbit pAb, BF700 conjugated
orb2849385 100 µL

NBPF11 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal CEP290 Antibody [PerCP]
NB100-86991PCP 0.1 mL

Rabbit Polyclonal CEP290 Antibody [PerCP]

Sign In for Pricing
View Details