Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11B Rabbit Polyclonal Antibody (Biotin)

BCL11B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha

UniProt

Q9C0K0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_612808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CMTM4 Antibody (1B9)
H00146223-M02 0.1 mg

Mouse Monoclonal CMTM4 Antibody (1B9)

Sign In for Pricing
View Details
NONO Antibody
orb1731612 100 µL

NONO Antibody

Sign In for Pricing
View Details
EIF4E (N-term) Rabbit Polyclonal Antibody
AP11780PU-N 400 µL

EIF4E (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida argR Protein (aa 1-155)
VAng-Cr6710-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida argR Protein (aa 1-155)

Sign In for Pricing
View Details
PPIAL4F ORF Vector (Human) (pORF)
37326011 1.0 µg DNA

PPIAL4F ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rat High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) ELISA Kit
RK14487 96 Tests

Rat High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) ELISA Kit

Sign In for Pricing
View Details