Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11B Rabbit Polyclonal Antibody (HRP)

BCL11B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha

UniProt

Q9C0K0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_612808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cacybp activation kit by CRISPRa
GA200489 1 Kit

Mouse Cacybp activation kit by CRISPRa

Sign In for Pricing
View Details
Benzylamine-d7
TRC-B224863-10MG 10 mg

Benzylamine-d7

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL
BNC880823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAZ (WWTR1) Human Gene Knockout Kit (CRISPR)
KN204082RB 1 Kit

TAZ (WWTR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
TA500590BM 100 µL

Alpha B Crystallin (CRYAB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

Sign In for Pricing
View Details
GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF812525 100 µg

GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

Sign In for Pricing
View Details