Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL11B Rabbit Polyclonal Antibody (FITC)

BCL11B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ATL1, RIT1, CTIP2, IMD49, CTIP-2, IDDFSTA, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha

UniProt

Q9C0K0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BCL11B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS37A (NM_152415) Human Tagged ORF Clone
RC209716 10 µg

VPS37A (NM_152415) Human Tagged ORF Clone

Sign In for Pricing
View Details
DPP3 Recombinant Antibody, Cy7 Conjugated
bsm-62520R-Cy7 100 µL

DPP3 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
SYT17 Recombinant Protein Antigen
NBP2-58999PEP 100 µL

SYT17 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)
MBS7028031-01 0.02 mg

Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details
Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)
MBS7028031-02 0.1 mg

Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details
Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)
MBS7028031-03 5x 0.1 mg

Recombinant Skeletonema costatum Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details