Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIOBP Rabbit Polyclonal Antibody (Biotin)

TRIOBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TARA, TAP68, DFNB28, dJ37E16.4, HRIHFB2122

UniProt

Q9H2D6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVGVITVPVLQTR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_619538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCL13 mRNA
HY-174770 500 µg

Human CCL13 mRNA

Sign In for Pricing
View Details
MAGEA3 (Melanoma Antigen Family A, 3, HIP8, HYPD, MAGE3, MAGEA6, MGC14613) (MaxLight 750) discontinued
248390-ML750 100 µL

MAGEA3 (Melanoma Antigen Family A, 3, HIP8, HYPD, MAGE3, MAGEA6, MGC14613) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G (i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 490) discontinued
036127-ML490 100 µL

GNAI2, NT (GNAI2, GNAI2B, Guanine nucleotide-binding protein G (i) subunit alpha-2, Adenylate cyclase-inhibiting G alpha protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Cd46 shRNA (UAS) - Lentiviral mouse Cd46 shRNA (UAS) plasmid
GTR15171583 1 Vial

Lentiviral mouse Cd46 shRNA (UAS) - Lentiviral mouse Cd46 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PDCD10 Antibody
MBS9402433-01 0.1 mL

PDCD10 Antibody

Sign In for Pricing
View Details
PDCD10 Antibody
MBS9402433-02 5x 0.1 mL

PDCD10 Antibody

Sign In for Pricing
View Details