Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIOBP Rabbit Polyclonal Antibody (HRP)

TRIOBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TARA, TAP68, DFNB28, dJ37E16.4, HRIHFB2122

UniProt

Q9H2D6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVGVITVPVLQTR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_619538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS644555 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human MT (Melatonin) ELISA Kit
E-EL-H2016-01 24 Tests

Human MT (Melatonin) ELISA Kit

Sign In for Pricing
View Details
Human MT (Melatonin) ELISA Kit
E-EL-H2016-02 48 Tests

Human MT (Melatonin) ELISA Kit

Sign In for Pricing
View Details
Human MT (Melatonin) ELISA Kit
E-EL-H2016-03 96 Tests

Human MT (Melatonin) ELISA Kit

Sign In for Pricing
View Details
Neomycin B Sulfate
TRC-N390043-50MG 50 mg

Neomycin B Sulfate

Sign In for Pricing
View Details
Pvalb Guinea Pig Polyclonal Antibody
24428 100 µL

Pvalb Guinea Pig Polyclonal Antibody

Sign In for Pricing
View Details