Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Brd8dc Rabbit Polyclonal Antibody (Biotin)

Brd8dc Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

4933408B17Rik

UniProt

Q8CDF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDLTTLKRNLSKGRIHTMAEFQRDLMLMFQNAVMYNDSDHHIYHMAVEMQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_808441

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 550)
124729-ML550 100 µL

CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 550)

Sign In for Pricing
View Details
Dram2 Mouse qPCR Template Standard (NM_001025582)
MK201673 1 Kit

Dram2 Mouse qPCR Template Standard (NM_001025582)

Sign In for Pricing
View Details
MRPS2 Protein Vector (Mouse) (pPM-C-His)
PV202205 500 ng

MRPS2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Auto Karl-Fischer Titrimeter
2053360 1 Each

Auto Karl-Fischer Titrimeter

Sign In for Pricing
View Details
Anti-NPY1R Antibody FITC
STJ501962 100 µg

Anti-NPY1R Antibody FITC

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r89 shRNA (UAS) - Lentiviral mouse Vmn1r89 shRNA (UAS, RFP) (25)
GTR15154655 1 Vial

Lentiviral mouse Vmn1r89 shRNA (UAS) - Lentiviral mouse Vmn1r89 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details