Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF513 Rabbit Polyclonal Antibody (Biotin)

ZNF513 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP58, Zfp513, HMFT0656

UniProt

Q8N8E2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF513

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSASEGWAPPHSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653232

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-MSEL-M0121-01 24 Tests

Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-MSEL-M0121-02 48 Tests

Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
E-MSEL-M0121-03 96 Tests

Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
2-Chloro-1-(3,4-dihydroxyphenyl)ethanone
TRC-C365325-1G 1 g

2-Chloro-1-(3,4-dihydroxyphenyl)ethanone

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), Biotin conjugate, 0.1mg/mL
BNCB3439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serum Amyloid P / APCS (APCS/3240), CF740 conjugate, 0.1mg/mL
BNC743240-500 1x 500 µL

Serum Amyloid P / APCS (APCS/3240), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details