Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDX Rabbit Polyclonal Antibody (HRP)

HDX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CXorf43, D030011N01Rik

UniProt

Q7Z353

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HDX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Myosin phosphatase ELISA Kit
GTR10384742 96 Well

Porcine Myosin phosphatase ELISA Kit

Sign In for Pricing
View Details
Multiplex Assay Kit for Neogenin 1 (NEO1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031783 96 Tests

Multiplex Assay Kit for Neogenin 1 (NEO1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
HGFL Rabbit Polyclonal Antibody
MBS9514843-01 0.05 mL

HGFL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HGFL Rabbit Polyclonal Antibody
MBS9514843-02 0.1 mL

HGFL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HGFL Rabbit Polyclonal Antibody
MBS9514843-03 5x 0.1 mL

HGFL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Naphthoxyacetic Acid 97% For Synthesis
01786 00025 25 g

2-Naphthoxyacetic Acid 97% For Synthesis

Sign In for Pricing
View Details