Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDX Rabbit Polyclonal Antibody (Biotin)

HDX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CXorf43, D030011N01Rik

UniProt

Q7Z353

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HDX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKADDKEQQQALLSDLPPELEEMDFNHASLEPDDTSFSVSSLSEKNVSES

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653258

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ring Finger Protein 98 (RNF98, Tripartite Motif-containing Protein 36, TRIM36, Zinc-binding Protein Rbcc728, E3 Ubiquitin-protein Ligase TRIM36, RBCC728) (MaxLight 750) discontinued
132590-ML750 100 µL

Ring Finger Protein 98 (RNF98, Tripartite Motif-containing Protein 36, TRIM36, Zinc-binding Protein Rbcc728, E3 Ubiquitin-protein Ligase TRIM36, RBCC728) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HSPD1 Antibody
orb1252879 100 µg

HSPD1 Antibody

Sign In for Pricing
View Details
Pde1b Mouse Pre-designed siRNA Set A
HY-RS17837 1 Set

Pde1b Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial
CSB-MP023449MO-01 20 µg

Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial

Sign In for Pricing
View Details
Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial
CSB-MP023449MO-02 100 µg

Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial

Sign In for Pricing
View Details
Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial
CSB-MP023449MO-03 1 mg

Recombinant Mouse Transforming growth factor beta-3 proprotein (Tgfb3), partial

Sign In for Pricing
View Details