Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp472 Rabbit Polyclonal Antibody (Biotin)

Zfp472 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Krim, Krim-, Krim1, KRIM-1, Krim-1A, Krim-1B

UniProt

E9Q2M4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLGEWTMLDSSQKKLYRDVMKETFLNLISIGKTEEEDTEEEYQNPKGNLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_694703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), 1mg/mL
BNUM2241-50 1x 50 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), 1mg/mL

Sign In for Pricing
View Details
C Reactive Protein (CRP) Mouse Monoclonal Antibody [Clone ID: OTI7C10]
CF807731 100 µg

C Reactive Protein (CRP) Mouse Monoclonal Antibody [Clone ID: OTI7C10]

Sign In for Pricing
View Details
Human CoCoA (CALCOCO1) activation kit by CRISPRa
GA111664 1 Kit

Human CoCoA (CALCOCO1) activation kit by CRISPRa

Sign In for Pricing
View Details
LTA (NM_000595) Human Over-expression Lysate
LC424627 20 µg

LTA (NM_000595) Human Over-expression Lysate

Sign In for Pricing
View Details
MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions
#30099 1 Kit

MemBrite® Fix 680/700 Cell Surface Staining Kit, 500 Reactions

Sign In for Pricing
View Details
STAT5A pSer780 Rabbit Polyclonal Antibody
AP20908PU-N 100 µg

STAT5A pSer780 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details