Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF498 Rabbit Polyclonal Antibody (HRP)

ZNF498 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF498

UniProt

Q14C99

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF498

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEPLVQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAI14574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-p40 phox Antibody
YLD5825-01 50 µL

Rabbit anti-p40 phox Antibody

Sign In for Pricing
View Details
Rabbit anti-p40 phox Antibody
YLD5825-02 100 µL

Rabbit anti-p40 phox Antibody

Sign In for Pricing
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 405) discontinued
C2398-08D-ML405 100 µL

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CLNS1A AAV Vector (Mouse) (CMV)
16366104 1 µg

CLNS1A AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Adrenal Lysate
1470 0.1 mg

Adrenal Lysate

Sign In for Pricing
View Details
Recombinant MICA Antibody
RC-16290-01 50 μL

Recombinant MICA Antibody

Sign In for Pricing
View Details